SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000499_2.0
Identity
ProteinSECIS binding protein 2 (SBP2)
SpeciesCholoepus hoffmanni (Sloth)
Protein IDSPP00000499
Protein release2.0
External IDNone
Transcript SPT00000491_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000499_2.0 # Protein # SECIS binding protein 2 (SBP2) # Sloth (Choloepus hoffmanni)
TDLLKELVRFQDRMYQKDPVKAKTKRQLVLGLREVLKHLKLKKLKCIIISPNCEKIQSKG
GLDDTLHTVIDCACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVEL
TMAARQAYKAMLENTQKELPGEPGPPSPPRPPALGPSCSAEAPSGNEQPQYIQIWRKHLE
AYYQCARELEESLEASASQMMNLNL%
Chart Advanced