SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001030_2.0
Identity
ProteinIodothyronine deiodinase 1 (DI1)
SpeciesGallus gallus (Chicken)
Protein IDSPP00001030
Protein release2.0
External IDNone
Transcript SPT00001022_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001030_2.0 # Protein # Iodothyronine deiodinase 1 (DI1) # Chicken (Gallus gallus)
MLSIRVLLHKLLILLQVTLSVVVGKTMMILFPDTTKRYILKLGEKSRMNQNPKFSYENWG
PTFFSFQYLLFVLKVKWRRLEDEAHEGRPAPNTPVVALNGEMQHLFSFMRDNRPLILNFG
SCTUPSFMLKFDEFNKLVKDFSSIADFLIIYIEEAHAVDGWAFRNNVVIKNHRSLEDRKT
AAQFLQQKNPLCPVVLDTMENLSSSKYAALPERLYILQAGNVIYKGGVGPWNYHPQEIRA
VLEKLK
Chart Advanced