SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002429_2.0
Identity
ProteinThioredoxin reductase 3 (TR3)
SpeciesSarcophilus harrisii (Tasmanian devil)
Protein IDSPP00002429
Protein release2.0
External IDNone
Transcript SPT00002421_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002429_2.0 # Protein # Thioredoxin reductase 3 (TR3) # Tasmanian devil (Sarcophilus harrisii)
VGAVLLRVASAARTAPRPLPASQEGADAGDSDHSDPFSFLGPMPPAGHSRLNPEPREDLR
RRLWRLIETNRVMIFSKSYCPYSTKVKELFTTLGVECKILELDLVDDGPRVQDLLLEITS
QKTVPNIFVNKIHMGGCDKTLQAHQSGLLQRLLQDESATYEYDLIVIGGGSGGLACSKEA
AVLGKKVMVLDFVKPSPLGTTWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNFGWEYE
EHVKHNWETMKEAIQNHIGSLNWGYRVSLRERAVTYSNAYAEFVEDHKIKATNKKGEETF
HTAGKFVIATGERPRYLGIPGDKEYCITSDDLFSLPYCPGNTLVVGASYVALECAGFLAG
IGLKVTVMVRSILLRGFDQEIAEKIGAYMEMNGVKFLRKYIPVKIQQLEEGTPGKLKVEA
KSTEGSETIEEEYNTVLLAIGRDSCTRKIGLEKIGVKINEKTGKIPVNDEEQTNVPYVYA
IGDVLEDKLELTPVAIQAGKLLARRLFGGRLEKCDYINVPTTVFTPLEYGCCGLSEEKAV
ELYKKDNVEVYHTFFWPVEWTIAGRENNACFGKIICNKHDNNRVIGFHVLGPNAGEITQG
FAAAMKCGLTKQLLDDTIGIHPTCGEIFTTMEITKSSGLSISQKGCUA%
Chart Advanced